Leptotrichia sp. oral taxon 847: AXF11_00970 Help Entry AXF11_00970       CDS       T04653                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism lot  Leptotrichia sp. oral taxon 847 Brite KEGG Orthology (KO) [BR:lot00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lot03032]     AXF11_00970    03036 Chromosome and associated proteins [BR:lot03036]     AXF11_00970    03400 DNA repair and recombination proteins [BR:lot03400]     AXF11_00970 DNA replication proteins [BR:lot03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AXF11_00970 Chromosome and associated proteins [BR:lot03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AXF11_00970 DNA repair and recombination proteins [BR:lot03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AXF11_00970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AMD94304 UniProt:  A0A0X8JSS7 LinkDB All DBs Position complement(212382..212669) Genome browser AA seq 95 aa AA seqDB search MSKKEFVEAYAKATKETKKRSEELVNAFLETVQEILEKGESVQFVGWGAFEIRERAAKDG RNPATGEKIHIPAKKVVKFKVGKKLADGVAKATKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaaaaagaatttgtcgaagcatatgctaaagcaaccaaagaaactaaaaaaaga tcggaagaattagtaaatgcttttttagaaacagtgcaggaaattttagaaaaaggagaa tcggttcagtttgttggctggggagcatttgagataagagaaagagcagcaaaagatgga agaaatccagcaacaggcgaaaaaatacatatacctgccaaaaaagtagtgaaatttaaa gttggaaaaaaattggctgatggagttgccaaagctacaaaaaaataa

DBGET integrated database retrieval system