Leptotrichia sp. oral taxon 847: AXF11_07595 Help Entry AXF11_07595       CDS       T04653                                  Name (GenBank) ATP F0F1 synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism lot  Leptotrichia sp. oral taxon 847 Pathway lot00190   Oxidative phosphorylation lot01100   Metabolic pathways Module lot_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:lot00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AXF11_07595  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:lot00194]     AXF11_07595 Photosynthesis proteins [BR:lot00194]  Photosystem and electron transport system   F-type ATPase [OT]    AXF11_07595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AMD95448 UniProt:  A0A109WD20 LinkDB All DBs Position 1626020..1626265 Genome browser AA seq 81 aa AA seqDB search MAATAEIINAAALLGAGIAAIGGVGAGLGQGIATGYAVEAISRQPEAKQDIMQTLITGLA ITESSAIYALVIAFLLIFLKG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcagcaacagcagaaatcattaatgcagcagcattgttaggagcagggatagcagca ataggaggagttggagcaggacttggacaagggattgcaacaggatatgcagtagaagct atttcaagacaacctgaagcaaaacaggacattatgcaaacgttgattacaggattggca attactgaatcatcagcaatttatgcgttagtaattgcgttcttattgattttcttaaaa ggatag

DBGET integrated database retrieval system