Lactobacillus panisapium: GYM71_06065 Help Entry GYM71_06065       CDS       T07602                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lpai  Lactobacillus panisapium Pathway lpai01100   Metabolic pathways lpai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GYM71_06065 (acpP)    00074 Mycolic acid biosynthesis     GYM71_06065 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GYM71_06065 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB PP-binding_2 Guanylate_cyc Ribosomal_L50 DEK_C ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QYN53828 UniProt:  A0ABX8W8J7 LinkDB All DBs Position complement(1293316..1293558) Genome browser AA seq 80 aa AA seqDB search MTEEEIFTKIRDILADNFEVDKDKITKETNFTNDLDADSIDLVEFILQLEDEFGSEISDE DAEKIKTVGDAVNYIAAHQK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaccgaagaagaaatttttaccaagattagagatattttggcagacaattttgaagtt gataaagataaaattacaaaggaaaccaattttaccaatgatttggatgcagattcaatt gatcttgttgaattcatcttgcagcttgaagatgaatttggctcagaaatttcagatgaa gatgctgagaaaataaaaacagtgggagatgcggttaattatattgcagctcaccaaaaa taa

DBGET integrated database retrieval system