Lysinibacillus pakistanensis: GDS87_03495 Help Entry GDS87_03495       CDS       T06280                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism lpak  Lysinibacillus pakistanensis Pathway lpak01100   Metabolic pathways lpak01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpak00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GDS87_03495    00074 Mycolic acid biosynthesis     GDS87_03495   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GDS87_03495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF6477 Motif Other DBs NCBI-ProteinID:  QGG50061 LinkDB All DBs Position 787269..787493 Genome browser AA seq 74 aa AA seqDB search MKETINEIVIEILELDEASEELLDREKNATWDSIKHLEIIMAIEEEFDIRFTATEVTAVK NIQDLYAYVEKKLV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaaagagacaataaatgaaatagtgattgaaattttagagttagatgaagcctcggaa gaacttctagatcgtgaaaaaaatgctacgtgggattcaattaaacacctagaaattatt atggctattgaagaagaattcgatattcgctttactgcaactgaagtaacagctgttaag aatatccaagatttatatgcatatgtagagaaaaaactagtgtag

DBGET integrated database retrieval system