Leishmania panamensis: LPMP_190830 Help Entry LPMP_190830       CDS       T06539                                  Name (RefSeq) dynein light chain, putative   KO K10418   dynein light chain LC8-type Organism lpan  Leishmania panamensis Pathway lpan04145   Phagocytosis lpan04517   IgSF CAM signaling lpan04814   Motor proteins Brite KEGG Orthology (KO) [BR:lpan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     LPMP_190830  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     LPMP_190830   09142 Cell motility    04814 Motor proteins     LPMP_190830  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lpan03037]     LPMP_190830    04812 Cytoskeleton proteins [BR:lpan04812]     LPMP_190830 Cilium and associated proteins [BR:lpan03037]  Motile cilia and associated proteins   Dynein arm    LPMP_190830 Cytoskeleton proteins [BR:lpan04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      LPMP_190830 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light LPMO11_C Abhydrolase_1 Motif Other DBs NCBI-GeneID:  22574137 NCBI-ProteinID:  XP_010698079 UniProt:  A0A088S775 LinkDB All DBs Position 19:<353099..>353437 Genome browser AA seq 112 aa AA seqDB search MSGTKVLIKESAMPVDMQQDCADCAAHALFTLKLHEQTELAQFIKKELDIKYGGQWHCIV GHSFGSCVGHDEAFFVYFEINSIFFSMWRMNKTLEAKQVSIDNAGRIVQATT NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgtctggaacgaaggtcctcatcaaagagtccgccatgccggtggatatgcaacaagac tgcgccgactgcgccgcacacgcgctcttcaccttgaagctacacgaacaaaccgaactc gctcagttcatcaagaaggagctggatatcaagtacggcgggcagtggcactgcatcgtc ggacactcttttggttcctgcgtcggccatgatgaggcgttcttcgtgtactttgagatc aacagcatcttctttagcatgtggaggatgaacaagacgctcgaagcgaagcaggtgtcg atcgacaatgcagggcgcattgtgcaggctaccacctag

DBGET integrated database retrieval system