Leishmania panamensis: LPMP_204130 Help Entry LPMP_204130       CDS       T06539                                  Name (RefSeq) hypothetical protein   KO K16780   sjoegren syndrome nuclear autoantigen 1 Organism lpan  Leishmania panamensis Brite KEGG Orthology (KO) [BR:lpan00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lpan03036]     LPMP_204130   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lpan03037]     LPMP_204130 Chromosome and associated proteins [BR:lpan03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     LPMP_204130 Cilium and associated proteins [BR:lpan03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    LPMP_204130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ADIP Tom22 DUF3450 IFT57 HMMR_C CC4_CEP85 CCDC28 PDC10_C COG6_N Lebercilin CorA Leu_zip Occludin_ELL OmpH BRE1 ERM_helical SKA2 FliD_N GAS FUSC DUF1664 CCDC113_CCDC96_CC Sec20 YabA ABC_tran_CTD USP8_interact Lectin_N Prefoldin_2 Motif Other DBs NCBI-GeneID:  22574624 NCBI-ProteinID:  XP_010698614 UniProt:  A0A088RP84 LinkDB All DBs Position 20:1697286..1697612 Genome browser AA seq 108 aa AA seqDB search MAALGSDVQATSVELVSVIEKMKERKARLEEQISAEEAEYEGLLAEVRTMQERLAALRDS VAKKQAVRADLERTISETYSAFKSILDASKKLLSTAKEESSALKSQIE NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggctgccctcgggtcagatgtgcaagccaccagtgtcgagctggtctctgtgattgag aaaatgaaggagcgcaaggcgcggcttgaagagcaaatctctgccgaggaggccgagtac gaaggcttgcttgccgaagtacgcacgatgcaggagcgactcgcagccctcagagacagt gtcgcgaagaagcaggcggtgcgcgcagacttggagcgaaccatatcggagacgtactcg gcattcaagagcatcctggatgcttcgaagaagctgttgtccactgccaaggaggagtca tcggcactcaagtcacaaatagagtga

DBGET integrated database retrieval system