Lacipirellula parvula: PLANPX_2046 Help Entry PLANPX_2046       CDS       T06590                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lpav  Lacipirellula parvula Pathway lpav01100   Metabolic pathways lpav01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpav00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PLANPX_2046   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PLANPX_2046 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BBO32434 UniProt:  A0A5K7X6T0 LinkDB All DBs Position 2296059..2296319 Genome browser AA seq 86 aa AA seqDB search MTRDEIKLEVLDILSDIAPDEDLSTLNDDQSFREQMELDSMDFLDIVMELRKRHRIQIPE DDYVNLASMTSTVTYLEPLMKDIQKV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacccgcgatgagatcaaactagaggtcctcgacatcttgtccgacatcgctcccgat gaggatttgtcgactctgaacgacgaccagagcttccgcgagcagatggagctcgacagc atggactttctcgacatcgtcatggagctgcgcaagcggcaccggattcagattccggaa gacgactacgtcaacctagcgagcatgacgtcgacggtgacgtatcttgagccgttgatg aaggatatccaaaaggtttaa

DBGET integrated database retrieval system