Secundilactobacillus paracollinoides: AYR62_06690 Help Entry AYR62_06690       CDS       T04675                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lpd  Secundilactobacillus paracollinoides Pathway lpd01100   Metabolic pathways lpd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AYR62_06690    00074 Mycolic acid biosynthesis     AYR62_06690   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AYR62_06690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 TerB Motif Other DBs NCBI-ProteinID:  ANZ63807 LinkDB All DBs Position complement(1502304..1502546) Genome browser AA seq 80 aa AA seqDB search MSKKETFNKIADIIADRFQVDRDKITDSLNFKTDLDADSIDFVEFILELEDTFGAEISDE DAENLNTVGEAVDYITSHSK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaaaaagaaacgtttaataagattgccgatattattgctgaccggttccaagtg gatcgcgacaagatcacggatagtctgaattttaaaactgatttggacgctgattccatt gattttgtggaatttatcttggagttggaagacacctttggcgctgaaatttccgacgaa gatgcggaaaacctaaacacggttggcgaagcggtggattacatcacaagccacagtaaa tag

DBGET integrated database retrieval system