Lolium perenne (perennial ryegrass): 127293298 Help Entry 127293298         CDS       T08650                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism lper  Lolium perenne (perennial ryegrass) Pathway lper03083   Polycomb repressive complex lper04120   Ubiquitin mediated proteolysis lper04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lper00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127293298    04120 Ubiquitin mediated proteolysis     127293298   09126 Chromosome    03083 Polycomb repressive complex     127293298  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lper04131]     127293298    04121 Ubiquitin system [BR:lper04121]     127293298    03036 Chromosome and associated proteins [BR:lper03036]     127293298 Membrane trafficking [BR:lper04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     127293298 Ubiquitin system [BR:lper04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      127293298    Cul7 complex      127293298 Chromosome and associated proteins [BR:lper03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      127293298   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      127293298 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BTB Motif Other DBs NCBI-GeneID:  127293298 NCBI-ProteinID:  XP_051178841 LinkDB All DBs Position 4:complement(91483298..91484077) Genome browser AA seq 148 aa AA seqDB search MAAEDKKITLKSSDGEQFEVDEAVAMESQTIRHMIEDDCADNGIPLPNVNAKILSKVVEY CSKHVQAADGAAAADGAPAPAPAEDLKNWDTEFVKVDQATLFDLILAANYLNIKGLLDLT CQTVADMIKGKTPEEIRKTFNIKNDFTP NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcggccgaggacaagaagatcacgctcaagtcatcggacggcgagcagttcgaggtg gacgaggcggtggcgatggagtcgcagacgatccgccacatgatcgaggacgactgcgcc gacaacgggatcccgctccccaacgtcaacgccaagatcctctccaaggtcgtcgagtac tgcagcaagcacgtccaggcggccgacggcgccgcggcggcggacggagctcccgccccg gcccccgccgaggacctcaagaactgggacaccgagttcgtcaaggtcgaccaggccacc ctcttcgacctcatcctcgccgccaactacctcaacatcaagggcctgctcgacctcacc tgccagaccgtcgccgacatgatcaagggcaagacacccgaggagatccgcaagaccttc aacatcaagaacgacttcaccccctag

DBGET integrated database retrieval system