Lolium perenne (perennial ryegrass): 127294745 Help Entry 127294745         CDS       T08650                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism lper  Lolium perenne (perennial ryegrass) Brite KEGG Orthology (KO) [BR:lper00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:lper03041]     127294745   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lper04052]     127294745 Spliceosome [BR:lper03041]  Complex B   Other components    Complex B specific factors     127294745 Cytokines and neuropeptides [BR:lper04052]  Neuropeptides   Unclassified    127294745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD OTU1_UBXL Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  127294745 NCBI-ProteinID:  XP_051180587 UniProt:  A0A0A7NTX7 LinkDB All DBs Position 4:169315948..169318314 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRPEKIRIQKWYTIYKDHITLGDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgctcaacgaccgtctggggaagaaggtgcgcgtcaagtgcaacgag gacgacaccatcggcgacctcaagaagctcgtggcggcgcagaccgggaccaggcccgag aagatccgcatccagaagtggtacaccatctacaaggaccacatcaccctcggcgactac gagatccacgacggaatgggactcgagctctactacaactag

DBGET integrated database retrieval system