Lolium perenne (perennial ryegrass): 127302456 Help Entry 127302456         CDS       T08650                                  Name (RefSeq) uncharacterized protein   KO K03505   DNA polymerase delta subunit 4 Organism lper  Lolium perenne (perennial ryegrass) Pathway lper03030   DNA replication lper03410   Base excision repair lper03420   Nucleotide excision repair lper03430   Mismatch repair lper03440   Homologous recombination Brite KEGG Orthology (KO) [BR:lper00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     127302456    03410 Base excision repair     127302456    03420 Nucleotide excision repair     127302456    03430 Mismatch repair     127302456    03440 Homologous recombination     127302456  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lper03032]     127302456    03400 DNA repair and recombination proteins [BR:lper03400]     127302456 DNA replication proteins [BR:lper03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     127302456 DNA repair and recombination proteins [BR:lper03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       127302456    MMR (mismatch excision repair)     DNA polymerase delta complex      127302456 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  127302456 NCBI-ProteinID:  XP_051188887 LinkDB All DBs Position 5:complement(242054329..242055933) Genome browser AA seq 121 aa AA seqDB search MASTGVKDFYRQKKKGGVAKTSSSSKKKTGASVGASNPAQMPALISHGSLDLKDDFSEQE EQLRQFDLDMKFGPCIGVNRLQRWERASAMGLQPPPHLRDLLTQASSVKNRNTECLWEGK I NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggcttctactggcgtgaaagatttctaccggcagaagaagaaaggaggtgtggccaaa acttcatcatcctctaagaagaaaacaggggcttctgttggggcctcaaaccctgctcag atgccagcactaatttctcacggatccttggatctgaaagatgacttcagtgagcaagag gagcagctgcggcagtttgacctggacatgaagttcggaccgtgcattggtgttaaccgg cttcagcgctgggagcgtgcttctgccatgggcctccagccaccgcctcatcttcgggat ctcttaactcaggcctcatctgttaagaatcgcaatactgagtgcctctgggagggtaaa atctag

DBGET integrated database retrieval system