Lolium perenne (perennial ryegrass): 127303702 Help Entry 127303702         CDS       T08650                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism lper  Lolium perenne (perennial ryegrass) Pathway lper03083   Polycomb repressive complex lper04120   Ubiquitin mediated proteolysis lper04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lper00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127303702    04120 Ubiquitin mediated proteolysis     127303702   09126 Chromosome    03083 Polycomb repressive complex     127303702  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lper04131]     127303702    04121 Ubiquitin system [BR:lper04121]     127303702    03036 Chromosome and associated proteins [BR:lper03036]     127303702 Membrane trafficking [BR:lper04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     127303702 Ubiquitin system [BR:lper04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      127303702    Cul7 complex      127303702 Chromosome and associated proteins [BR:lper03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      127303702   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      127303702 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  127303702 NCBI-ProteinID:  XP_051190369 LinkDB All DBs Position 5:complement(160591483..160591923) Genome browser AA seq 146 aa AA seqDB search MITLKSSDGEQFETTREAAAMSQTIQHLIEDNCMDNGVPLPNVDSKTLAMVMEYCNKHVA DSADEEGLKSFDESFIKVDPDTLFDIILAANNLEIKGLLDLSSQRVADMIKGKSAEEIRK TLNIKNDYTPEEEEKNRRENPWAFRD NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgatcacgctgaagagctccgacggtgagcaattcgagacgacccgggaggcggcggcg atgtcgcagaccatccagcacctgatcgaggacaactgcatggacaacggcgtccctctc cccaacgtcgactctaaaacccttgccatggtcatggagtactgcaacaagcacgtcgcc gacagtgcggacgaggagggcctcaagagcttcgacgagagctttatcaaggtggatccg gacacgctgttcgacatcatcctcgccgccaacaatctggaaatcaaggggctcctggac ctcagcagccagagggtcgccgatatgatcaagggtaagtcggctgaggagattcggaag acgctcaacatcaagaacgactacacgccggaggaggaggagaagaaccgaagggagaac ccgtgggcgtttcgcgattga

DBGET integrated database retrieval system