Lolium perenne (perennial ryegrass): 127314719 Help Entry 127314719         CDS       T08650                                  Name (RefSeq) uncharacterized protein   KO K03505   DNA polymerase delta subunit 4 Organism lper  Lolium perenne (perennial ryegrass) Pathway lper03030   DNA replication lper03410   Base excision repair lper03420   Nucleotide excision repair lper03430   Mismatch repair lper03440   Homologous recombination Brite KEGG Orthology (KO) [BR:lper00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     127314719    03410 Base excision repair     127314719    03420 Nucleotide excision repair     127314719    03430 Mismatch repair     127314719    03440 Homologous recombination     127314719  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lper03032]     127314719    03400 DNA repair and recombination proteins [BR:lper03400]     127314719 DNA replication proteins [BR:lper03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     127314719 DNA repair and recombination proteins [BR:lper03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       127314719    MMR (mismatch excision repair)     DNA polymerase delta complex      127314719 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  127314719 NCBI-ProteinID:  XP_051201197 LinkDB All DBs Position 7:complement(185385184..185386071) Genome browser AA seq 119 aa AA seqDB search MRSDGDVKSFFRQQKARSGAAAAAKPTGGVSKKAALPHQKRAAALLFHPTPDHVDGADAR REDEDRERKAREFDMDMRYGPCLGLTRAQRWHRADALGLAPPPHALCSDDQPCLWEGRV NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgaggagcgacggcgacgtcaagtccttcttccggcagcagaaggcccgctccggcgcg gcggcggccgccaagcccaccggcggcgtctccaagaaggcggcgctcccccaccagaag cgggcggcggcgcttctcttccaccctacacctgatcacgtcgacggagcggacgcgagg agggaggacgaggacagggagaggaaggcccgggagttcgacatggacatgcgctacggg ccctgcctcggcctcacccgcgcccagcgctggcaccgcgccgacgcgctaggcctcgcc ccgccgccgcacgcgctctgctccgacgaccagccctgcctctgggagggccgcgtctag

DBGET integrated database retrieval system