Lolium perenne (perennial ryegrass): 127314832 Help Entry 127314832         CDS       T08650                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism lper  Lolium perenne (perennial ryegrass) Pathway lper03018   RNA degradation lper03040   Spliceosome Brite KEGG Orthology (KO) [BR:lper00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     127314832   09123 Folding, sorting and degradation    03018 RNA degradation     127314832  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lper03019]     127314832    03041 Spliceosome [BR:lper03041]     127314832 Messenger RNA biogenesis [BR:lper03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      127314832   mRNA degradation factors    5'-3' decay     Lsm complex      127314832 Spliceosome [BR:lper03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     127314832  Complex C   U2 snRNP components     127314832 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX LSM14 DUF1256 DUF150_C Motif Other DBs NCBI-GeneID:  127314832 NCBI-ProteinID:  XP_051201319 LinkDB All DBs Position 7:179385548..179389007 Genome browser AA seq 93 aa AA seqDB search MLFFSYFKELVGKEVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQEKYPHMLSVRNC FIRGSVVRYVLLPQDGVDIDILHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgctgttcttctcctacttcaaggagctcgtcgggaaggaagtgacagtggagctcaag aacgacctggccatccgtggcacgctccactcggtcgatcagtacctcaacatcaagctc gagaacactcgggtcgtcgaccaggagaagtacccccacatgctatcggtgcggaactgc ttcatcagaggatctgtggtgcggtacgtgctccttccacaggacggggttgacatcgac atcctccatgatgccaccaggagggaggcacggggcggctga

DBGET integrated database retrieval system