Lolium perenne (perennial ryegrass): 127315994
Help
Entry
127315994 CDS
T08650
Name
(RefSeq) histidine-containing phosphotransfer protein 1-like
KO
K14490
histidine-containing phosphotransfer peotein
Organism
lper
Lolium perenne (perennial ryegrass)
Pathway
lper04075
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:
lper00001
]
09130 Environmental Information Processing
09132 Signal transduction
04075 Plant hormone signal transduction
127315994
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Hpt
Motif
Other DBs
NCBI-GeneID:
127315994
NCBI-ProteinID:
XP_071679881
LinkDB
All DBs
Position
7:109846032..109860917
Genome browser
AA seq
85 aa
AA seq
DB search
MAAVMKLDTLGYAARMFSRRLLDEQFQQLLLLQDGSEENLVAKIVTLFCQEAERIIGELS
MQLDKPYVNFEEVAAFADKLEGSSA
NT seq
258 nt
NT seq
+upstream
nt +downstream
nt
atggcggccgtgatgaagctcgacacccttggttatgcagccaggatgttcagcaggcgt
ttgttggacgagcagttccagcagctgcttctgctccaggatgggagcgaagagaatctc
gttgccaagatcgtcaccctcttctgccaggaagccgagcggatcattggcgagctctct
atgcagctggacaagccatatgtgaacttcgaagaggtggctgcttttgcggataagctt
gaggggagcagtgcatga
DBGET
integrated database retrieval system