Lolium perenne (perennial ryegrass): 127336061 Help Entry 127336061         CDS       T08650                                  Name (RefSeq) ubiquitin   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism lper  Lolium perenne (perennial ryegrass) Pathway lper03010   Ribosome lper04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:lper00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     127336061   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     127336061  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:lper03011]     127336061    04121 Ubiquitin system [BR:lper04121]     127336061 Ribosome [BR:lper03011]  Ribosomal proteins   Eukaryotes    Large subunit     127336061   Archaea     127336061 Ubiquitin system [BR:lper04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    127336061 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD UBL_UBAC1 Plexin_RBD DUF2604 Ubiquitin_5 Dsc3_N OTU1_UBXL HATPase_c Motif Other DBs NCBI-GeneID:  127336061 NCBI-ProteinID:  XP_051218782 LinkDB All DBs Position 2:complement(299037550..299038627) Genome browser AA seq 77 aa AA seqDB search MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN IQKESTLHLVLRLRGGL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccctgaccggcaagaccatcaccctagaggtggagtcctct gacacgatcgacaacgttaaggcgaagatccaggacaaggagggcatcccgccggaccag cagcgcctcatctttgctggcaagcagcttgaggatggccgtaccctcgccgactacaac atccagaaggagtccactctccacctcgtcctgcgcctccgcggtggcctttaa

DBGET integrated database retrieval system