Lolium perenne (perennial ryegrass): 127337010 Help Entry 127337010         CDS       T08650                                  Name (RefSeq) sm-like protein LSM7   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism lper  Lolium perenne (perennial ryegrass) Pathway lper03018   RNA degradation lper03040   Spliceosome Brite KEGG Orthology (KO) [BR:lper00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     127337010   09123 Folding, sorting and degradation    03018 RNA degradation     127337010  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lper03019]     127337010    03041 Spliceosome [BR:lper03041]     127337010 Messenger RNA biogenesis [BR:lper03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      127337010   mRNA degradation factors    5'-3' decay     Lsm complex      127337010 Spliceosome [BR:lper03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     127337010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF150_C Hfq Motif Other DBs NCBI-GeneID:  127337010 NCBI-ProteinID:  XP_051219831 LinkDB All DBs Position 2:complement(303342943..303345871) Genome browser AA seq 100 aa AA seqDB search MAGRKETALDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVESEREQDDPLKL TTKTRQLGLIVCRGTAVMLVSPTDGTDEIANPFLAADGAS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcggggcgcaaggagaccgcacttgacctagccaagttcgtcgacaagggcgtccag gtcaagctcaccggcggccgccaagttactggaactttgaagggctatgaccagttgctg aacctagtgctggatgaagcagttgagtctgaaagagagcaagatgacccattgaaattg acaacgaaaaccagacaacttggtctcatagtgtgtagaggtactgcagtcatgctggtg tcaccaactgatggaactgatgagattgccaacccttttcttgcagccgatggggcatca taa

DBGET integrated database retrieval system