Lolium perenne (perennial ryegrass): 127344916 Help Entry 127344916         CDS       T08650                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism lper  Lolium perenne (perennial ryegrass) Pathway lper04145   Phagocytosis lper04517   IgSF CAM signaling lper04814   Motor proteins Brite KEGG Orthology (KO) [BR:lper00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     127344916  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     127344916   09142 Cell motility    04814 Motor proteins     127344916  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lper03037]     127344916    04812 Cytoskeleton proteins [BR:lper04812]     127344916 Cilium and associated proteins [BR:lper03037]  Motile cilia and associated proteins   Dynein arm    127344916 Cytoskeleton proteins [BR:lper04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      127344916 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  127344916 NCBI-ProteinID:  XP_051227235 LinkDB All DBs Position 6:complement(93216819..93217681) Genome browser AA seq 97 aa AA seqDB search MLEGKALVEDTDMPPRMQAAATSAASHALDLFDVTDCRAIAGHIKTEFDKRYGVGWQCVV GANFGCFFTHSSGTFIYFSLERLTFLLFRAAAVAAAS NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctggaggggaaggcgctggtggaggacacagacatgccgccgcggatgcaggcggcg gccacgtccgccgcctcccacgcgctcgacctcttcgacgtcaccgactgccgcgccatc gccggtcacatcaagacggagttcgacaagcggtacggcgtcgggtggcagtgcgtggtg ggcgccaacttcgggtgcttcttcacccattccagcggcaccttcatctacttctccctg gagcgcctcaccttcctcctcttcagggccgccgccgttgccgcggcttcctaa

DBGET integrated database retrieval system