Lolium perenne (perennial ryegrass): 127345726 Help Entry 127345726         CDS       T08650                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism lper  Lolium perenne (perennial ryegrass) Pathway lper04145   Phagosome lper04148   Efferocytosis lper04517   IgSF CAM signaling lper04518   Integrin signaling lper04620   Toll-like receptor signaling pathway lper05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lper00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     127345726    04518 Integrin signaling     127345726  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     127345726    04148 Efferocytosis     127345726  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127345726  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     127345726  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lper04131]     127345726   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lper04147]     127345726    04031 GTP-binding proteins [BR:lper04031]     127345726 Membrane trafficking [BR:lper04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     127345726  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     127345726   Macropinocytosis    Ras GTPases     127345726  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     127345726 Exosome [BR:lper04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127345726   Exosomal proteins of other body fluids (saliva and urine)    127345726   Exosomal proteins of colorectal cancer cells    127345726   Exosomal proteins of bladder cancer cells    127345726 GTP-binding proteins [BR:lper04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     127345726 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  127345726 NCBI-ProteinID:  XP_051228188 LinkDB All DBs Position 3:324981173..324984897 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLRDDEQFFVDHPGAVPISTTQGEELKKVIGATAYIECSSKTQQNIKAVFDAAIKVVLQP PKQRRRKRKARKGCAIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtcccggttcataaagtgcgtgacggtgggggacggcgccgtgggcaagacc tgcctcctcatctcctacacctccaacaccttccccacggattatgtcccgactgtcttt gacaacttcagcgcaaacgtcgtcgttgatggaagcaccgtcaacctgggcttgtgggat acagcaggacaagaggactacaacaggctacgcccgctgagctaccgcggagccgacgtc ttcctgctcgccttctccctcatcagcaaagcaagctacgagaacgtctccaagaagtgg attcctgaattgaggcactatgctcctggtgtgcccatcattcttgttggcacaaagctc gatctgcgggatgacgaacagtttttcgtggaccaccccggtgcggttcctatctccacc actcagggcgaggagctgaaaaaggtaatcggcgcgacagcatacatcgagtgcagttcc aaaacgcagcagaacatcaaggctgtcttcgacgcggcgatcaaggtggttctccagccc ccgaagcagaggcggaggaagaggaaggcgcggaaagggtgtgccatcttatga

DBGET integrated database retrieval system