Lolium perenne (perennial ryegrass): 139830059 Help Entry 139830059         CDS       T08650                                  Name (RefSeq) uncharacterized protein   KO K11270   chromosome transmission fidelity protein 8 Organism lper  Lolium perenne (perennial ryegrass) Brite KEGG Orthology (KO) [BR:lper00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lper03036]     139830059 Chromosome and associated proteins [BR:lper03036]  Eukaryotic type   Sister chromatid cohesion proteins    CTF18-RFC complex     139830059 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ctf8 Motif Other DBs NCBI-GeneID:  139830059 NCBI-ProteinID:  XP_071676411 LinkDB All DBs Position 1:126309521..126309917 Genome browser AA seq 89 aa AA seqDB search SQGAYTFTIGYHELAGTRVTLKKPLLVLRKKKNDGQGGPAAAVELDVIGVIRHKILFKDR PKALISKVPVKEKKVLPSVAAPSAVSPTS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt tcccagggcgcgtacaccttcaccatagggtaccacgagctcgccgggaccagggttact ctcaagaagcccctgctggtgctgaggaagaagaagaacgatggccaaggtggaccggcg gcggcggtggagctggacgtgatcggcgtcatccggcacaagatcctcttcaaggaccgc cccaaggctctcatctcaaaggtcccggtgaaggagaagaaggtactgccgtcggtggcg gcgccatcagccgtatctcccacttcctga

DBGET integrated database retrieval system