Lolium perenne (perennial ryegrass): 139832549 Help Entry 139832549         CDS       T08650                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism lper  Lolium perenne (perennial ryegrass) Brite KEGG Orthology (KO) [BR:lper00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:lper03041]     139832549   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lper04052]     139832549 Spliceosome [BR:lper03041]  Complex B   Other components    Complex B specific factors     139832549 Cytokines and neuropeptides [BR:lper04052]  Neuropeptides   Unclassified    139832549 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  139832549 NCBI-ProteinID:  XP_071678433 LinkDB All DBs Position 6:complement(163773568..163774944) Genome browser AA seq 74 aa AA seqDB search MTVVLNDRLGTKVRVKPSSATMTTRCDLKKLVAAQTGTRAKTIRIQKWYNIYKDHITIAD YEIHDSMGLELYYN NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacggtggtgctgaacgaccggctggggacgaaggtgcgcgtcaagccgtcaagtgca acgatgacgacacgatgtgacctgaagaagctggtggcagcgcagacggggacgcgcgcc aagacgatccgcatccagaagtggtacaacatctacaaggaccacatcaccatcgccgac tacgagatccacgacagcatgggcctcgagctctactacaactag

DBGET integrated database retrieval system