Lolium perenne (perennial ryegrass): 5696595 Help Entry 5696595           CDS       T08650                                  Symbol atpH, LopeCp028 Name (RefSeq) ATP synthase CF0 III   KO K02110   F-type H+-transporting ATPase subunit c Organism lper  Lolium perenne (perennial ryegrass) Pathway lper00190   Oxidative phosphorylation lper00195   Photosynthesis lper01100   Metabolic pathways Module lper_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:lper00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     5696595 (atpH)    00195 Photosynthesis     5696595 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:lper00194]     5696595 (atpH) Photosynthesis proteins [BR:lper00194]  Photosystem and electron transport system   F-type ATPase [OT]    5696595 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  5696595 NCBI-ProteinID:  YP_001531278 UniProt:  A8Y9G5 LinkDB All DBs Position Pltd:31738..31983 Genome browser AA seq 81 aa AA seqDB search MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactaattgctgctgcttctgttattgctgctggattggccgtagggcttgct tctattgggcctggagttggtcaaggtactgctgcaggacaagctgtagaaggtattgcg agacagccagaagcagaaggtaaaatacgaggtactttattgcttagtctagcttttatg gaagctttaacaatttatggactagttgtggcactagcgcttttatttgcgaaccctttt gtttaa

DBGET integrated database retrieval system