Lytechinus pictus (painted urchin): 129253626 Help Entry 129253626         CDS       T09066                                  Name (RefSeq) centromere protein S-like   KO K11511   centromere protein S Organism lpic  Lytechinus pictus (painted urchin) Pathway lpic03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:lpic00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     129253626  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lpic03036]     129253626    03400 DNA repair and recombination proteins [BR:lpic03400]     129253626 Chromosome and associated proteins [BR:lpic03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      129253626 DNA repair and recombination proteins [BR:lpic03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      129253626 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone Bromo_TP DUF7721 Motif Other DBs NCBI-GeneID:  129253626 NCBI-ProteinID:  XP_054748027 LinkDB All DBs Position 2:80841473..80848677 Genome browser AA seq 127 aa AA seqDB search MQDFSVFVFPQRLKAAVHFTTGQICGELGEELDVTFSRQFISALAETTFKQMEIFACDLE SFAQHAKRSTINSEDVKLLTRRSKDLNAHISTLSARQIAENDAVKEKKKGKRGRKAKPVV ETEDDLE NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgcaagatttctctgtgtttgtatttccacagcgtcttaaggctgcagtacatttcacc actggacagatttgtggggagcttggggaagaattggatgtgacattctccaggcaattc atttcggctcttgcagagacaaccttcaaacaaatggaaatctttgcttgtgatctggag tcctttgctcagcatgctaaacggtcaactattaattctgaagatgttaaacttttgaca aggagaagtaaagatcttaatgctcacatcagtaccctaagtgcaaggcaaatagcagaa aatgatgcagtgaaagagaaaaagaaaggaaagagaggacgaaaagcaaaacctgtagtg gaaactgaagatgatctagagtga

DBGET integrated database retrieval system