Lytechinus pictus (painted urchin): 129254721 Help Entry 129254721         CDS       T09066                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism lpic  Lytechinus pictus (painted urchin) Pathway lpic04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:lpic00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     129254721  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lpic04121]     129254721    03400 DNA repair and recombination proteins [BR:lpic03400]     129254721 Ubiquitin system [BR:lpic04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      129254721    Cul5 complex      129254721 DNA repair and recombination proteins [BR:lpic03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      129254721 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  129254721 NCBI-ProteinID:  XP_054749207 LinkDB All DBs Position 2:69276211..69287148 Genome browser AA seq 120 aa AA seqDB search MDVFLMIKRQKTTIFTDAKETNTVFELKRIIEGITKKSPEDQQLYKDGDTLDDTKTLGDC GLTSNTAKAQAPAMLGLAFRECEGADFEQLNITPYSNPPELPDVMKPSDSTTNTVDQPVQ NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatgtcttcttgatgatcaagcgtcagaagacgaccatcttcactgatgcaaaggag acaaacactgtatttgaactgaagcgaatcattgagggcattaccaagaagtcaccagaa gaccaacagctgtacaaggatggagacacactagatgataccaagacactgggagactgt ggactaacaagcaacactgccaaggcacaagcaccagccatgcttgggcttgccttcaga gaatgtgaaggtgctgactttgagcaattaaacatcacaccctactccaatcccccagag ctgcctgacgttatgaagccatcagattccacaaccaacacagtagatcaaccagtccaa tag

DBGET integrated database retrieval system