Lytechinus pictus (painted urchin): 129258885 Help Entry 129258885         CDS       T09066                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism lpic  Lytechinus pictus (painted urchin) Pathway lpic04814   Motor proteins Brite KEGG Orthology (KO) [BR:lpic00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     129258885  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lpic03037]     129258885    04812 Cytoskeleton proteins [BR:lpic04812]     129258885 Cilium and associated proteins [BR:lpic03037]  Motile cilia and associated proteins   Dynein arm    129258885 Cytoskeleton proteins [BR:lpic04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      129258885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 PTP2 RE_TdeIII Motif Other DBs NCBI-GeneID:  129258885 NCBI-ProteinID:  XP_054753099 LinkDB All DBs Position 4:complement(20215830..20219793) Genome browser AA seq 113 aa AA seqDB search MDDFQTAEETTFVVDEVSNIIKEAVEGTIGGSAYQHNKVNQWTSNVVEQCLNQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSTDGSCTVRWENKTMYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggatgattttcaaactgccgaagagacgacatttgttgtggatgaagtgagtaacatt atcaaggaagccgtagaagggaccatcggaggcagtgcttaccaacacaacaaggtcaat cagtggacgtcaaatgtagtcgagcagtgtctaaatcaactcaccaaactaggaaagcct ttcaaatatattgtcacatgtgtgatcatgcagaagaacggtgccggcctacacacagcc agttcgtgtttctgggataactccaccgacggcagctgtactgtcagatgggaaaacaag accatgtattgcattgtgagtgtctttggattggccatctaa

DBGET integrated database retrieval system