Lytechinus pictus (painted urchin): 129259003 Help Entry 129259003         CDS       T09066                                  Name (RefSeq) c-Myc-binding protein-like   KO K25550   c-Myc-binding protein Organism lpic  Lytechinus pictus (painted urchin) Brite KEGG Orthology (KO) [BR:lpic00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lpic03037]     129259003 Cilium and associated proteins [BR:lpic03037]  Motile cilia and associated proteins   Sperm associated proteins    129259003 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TSC22 ZapB Wtap CCDC92 DivIC SOGA HALZ YabA LPP Herpes_BLRF2 DUF6381 CAP_N bZIP_2 SlyX Motif Other DBs NCBI-GeneID:  129259003 NCBI-ProteinID:  XP_054753243 LinkDB All DBs Position 4:29703950..29714986 Genome browser AA seq 103 aa AA seqDB search MTTYRPGDSKREEFRKYLEKAGVLDALTKILVALYEEPEKPNDALDFLKAHMGQSGPDTA DVESLRLQVSELMQKVERLQDENRELKAKVQMENPEVEPSAEN NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgacaacatacaggcctggagattcaaagcgggaggagttccgcaagtacctggagaaa gctggagtcttggatgctctcacaaagatactggtagccctgtatgaagagccagagaaa ccaaatgatgcactagacttcctgaaagctcacatgggtcagtcaggaccagacacggct gatgtagaatctctgagactacaggtcagtgaactgatgcagaaggtggaacggctacag gatgagaatagggaactcaaagcaaaggttcagatggaaaatccggaggttgagccaagt gcagagaactga

DBGET integrated database retrieval system