Lytechinus pictus (painted urchin): 129265910 Help Entry 129265910         CDS       T09066                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism lpic  Lytechinus pictus (painted urchin) Pathway lpic04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:lpic00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     129265910  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lpic01009]     129265910   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lpic04131]     129265910    03036 Chromosome and associated proteins [BR:lpic03036]     129265910   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lpic04147]     129265910 Protein phosphatases and associated proteins [BR:lpic01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      129265910 Membrane trafficking [BR:lpic04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     129265910 Chromosome and associated proteins [BR:lpic03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      129265910 Exosome [BR:lpic04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129265910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg EF-hand_10 FCaBP_EF-hand DUF5580_M AIF-1 EF_EFCAB10_C EF-hand_11 Motif Other DBs NCBI-GeneID:  129265910 NCBI-ProteinID:  XP_054759796 LinkDB All DBs Position 7:32159134..32166844 Genome browser AA seq 85 aa AA seqDB search MMMRRPQAESTYSEEDIRGCFKTLDKDDNGCISAKELREALGEACINMSKEKADQLIKEC DKNGDGLVNYEEFVQMLVNVLLSTS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgatgatgagaagaccacaagcggaatccacatacagtgaagaggatattcgaggatgt ttcaaaacacttgacaaagatgacaacggttgtatcagtgctaaggagttgcgagaggct ttgggcgaggcttgtatcaacatgtctaaagagaaagctgatcaattgatcaaggaatgt gacaagaatggtgacggtttggtcaactatgaagaattcgtccagatgttggtgaatgtt ctactttccacttcataa

DBGET integrated database retrieval system