Lytechinus pictus (painted urchin): 129270324 Help Entry 129270324         CDS       T09066                                  Name (RefSeq) ras-related protein Rac1-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism lpic  Lytechinus pictus (painted urchin) Pathway lpic04145   Phagosome lpic04148   Efferocytosis lpic04310   Wnt signaling pathway lpic04620   Toll-like receptor signaling pathway lpic05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lpic00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     129270324  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     129270324    04148 Efferocytosis     129270324  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129270324  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     129270324  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lpic04131]     129270324   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lpic04147]     129270324    04031 GTP-binding proteins [BR:lpic04031]     129270324 Membrane trafficking [BR:lpic04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     129270324  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     129270324   Macropinocytosis    Ras GTPases     129270324  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     129270324 Exosome [BR:lpic04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129270324   Exosomal proteins of other body fluids (saliva and urine)    129270324   Exosomal proteins of colorectal cancer cells    129270324   Exosomal proteins of bladder cancer cells    129270324 GTP-binding proteins [BR:lpic04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     129270324 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  129270324 NCBI-ProteinID:  XP_054763696 LinkDB All DBs Position 10:complement(28025839..28044159) Genome browser AA seq 189 aa AA seqDB search MIGPTRAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPVNLGLWDTAGQEDYDR LRPLSYPQTDVFLICFSLVSPASCENARDKWHPEVSHHCPNTPIILVGTKLDLREDKETV DKLAQRRLRPITYALGLQIMKEINGVKYLECSALTQKGLKTVFDEAIRAVLCPDQHKKKK KKGKSCKLI NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgatcggaccaaccagagctgttggtaagacatgtcttctcatcagttacaccacaaat gctttccctggagaatacattcccactgtgtttgataattactctgccaatgtgatggtt gatggtcgtccagtgaacttaggattatgggatactgctggtcaggaagattatgacagg ctgagaccactctcatacccccaaacagatgtatttctcatctgcttttcactggtgagc cctgcatcttgtgaaaatgcgcgagacaagtggcatccagaagttagccatcattgtccc aacacacctatcattttagtgggaaccaagttggatcttcgggaagataaagagacggtt gataagctagcccaaaggagactcagacccatcacatacgccttgggtctgcagataatg aaggagatcaatggtgtcaagtacttggaatgctctgctctcactcaaaaaggcctcaag acagtgtttgatgaagccatcagagcggtactttgtccagatcaacataagaagaagaag aagaagggcaagagttgtaaattaatctga

DBGET integrated database retrieval system