Lytechinus pictus (painted urchin): 129282737 Help Entry 129282737         CDS       T09066                                  Name (RefSeq) ras-related protein R-Ras2-like   KO K07830   Ras-related protein R-Ras2 Organism lpic  Lytechinus pictus (painted urchin) Pathway lpic04137   Mitophagy - animal lpic04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:lpic00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129282737    04137 Mitophagy - animal     129282737  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lpic04147]     129282737    04031 GTP-binding proteins [BR:lpic04031]     129282737 Exosome [BR:lpic04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129282737   Exosomal proteins of bladder cancer cells    129282737 GTP-binding proteins [BR:lpic04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129282737 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 HRI2_3H HMUD2 Motif Other DBs NCBI-GeneID:  129282737 NCBI-ProteinID:  XP_054774577 LinkDB All DBs Position 19:complement(18318315..18330739) Genome browser AA seq 140 aa AA seqDB search MTSQGSHNGPMHKIVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCVIDNVVCK LDILDTAGQDEFSAMREQYMRTGDGFLLVFALSNRTSFDEIYKYHRQILRVKDRDEFPMI LIGNKADLEDSRVVSITILF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgacatcacaaggatctcataatggacctatgcataaaattgtcgttgtaggaggcgga ggtgttggtaaaagtgccattacgatacagtttatacagtcttactttgtaacggattat gacccaacgatagaagactcgtacaccaaacaatgcgtcatagataacgtcgtctgtaaa ttggacattcttgacacagcaggccaggatgaattcagtgcaatgagagagcaatacatg aggacgggtgatggattcttactagtattcgccctttcaaacagaacaagttttgatgaa atttacaagtaccatcggcagatcctccgcgtcaaggatagggacgaattccccatgatc ctcatcggaaacaaagcagatttggaggatagcagagtagtgagtataaccattttgttt tga

DBGET integrated database retrieval system