Limnochorda pilosa: LIP_0091 Help Entry LIP_0091          CDS       T04150                                  Name (GenBank) YruB family glutaredoxin   KO K03676   glutaredoxin 3 Organism lpil  Limnochorda pilosa Brite KEGG Orthology (KO) [BR:lpil00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:lpil03110]     LIP_0091 Chaperones and folding catalysts [BR:lpil03110]  Protein folding catalysts   Protein disulfide isomerase    LIP_0091 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like DSBA GST_N_2 GST_N CBS ddrB-ParB Thioredoxin_3 GST_N_4 Zn_ribbon_TEX13 PrkC-like_PASTA-like Motif Other DBs NCBI-ProteinID:  BAS25948 UniProt:  A0A0K2SFR4 LinkDB All DBs Position 100762..100998 Genome browser AA seq 78 aa AA seqDB search MARVTVYSTPTCPWCNAAKRYLRQRGVPFRDVDVSRDRREAERMMHRSGQTGVPVVEIDG KVIVGFDRARIDRALDLR NT seq 237 nt NT seq  +upstreamnt  +downstreamnt ttggctcgagtgacggtctactccaccccgacctgcccctggtgcaacgccgccaagcgt tacctgcgccagcggggtgtgcccttccgggacgtggacgtctcccgcgaccgcagggag gccgagcgcatgatgcacaggtcggggcagacgggcgtgcccgtggtggagatcgacggc aaggtgatcgtgggcttcgaccgggcccgtatcgaccgggccctcgacctcaggtag

DBGET integrated database retrieval system