Lactococcus piscium: LACPI_0830 Help Entry LACPI_0830        CDS       T03909                                  Symbol acpP Name (GenBank) Acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism lpk  Lactococcus piscium Pathway lpk01100   Metabolic pathways lpk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LACPI_0830 (acpP)    00074 Mycolic acid biosynthesis     LACPI_0830 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LACPI_0830 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  CEN28030 UniProt:  A0A0D6DVL9 LinkDB All DBs Position I:862929..863156 Genome browser AA seq 75 aa AA seqDB search MSVFEKVQEIIVEELGKEASEITLETSFESLDADSLDIFQIINEIEDEYDIAIETEDGLN TVGDLVKFVDAKIAE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtctgtatttgaaaaagttcaagaaattattgttgaagaactcggtaaagaagcaagt gaaattacacttgaaacatcatttgagtcacttgatgctgattcacttgatatcttccaa atcatcaacgaaattgaagatgaatacgatatcgcaatcgaaactgaagatggcttaaac accgtaggtgacttagtcaaattcgtagatgcgaaaattgctgaataa

DBGET integrated database retrieval system