Lactiplantibacillus plantarum WCFS1: lp_1672 Help Entry lp_1672           CDS       T00115                                  Symbol acpA2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lpl  Lactiplantibacillus plantarum WCFS1 Pathway lpl01100   Metabolic pathways lpl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     lp_1672 (acpA2)    00074 Mycolic acid biosynthesis     lp_1672 (acpA2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     lp_1672 (acpA2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 DUF6290 PP-binding_2 Motif Other DBs NCBI-ProteinID:  CCC78975 UniProt:  F9UP36 LinkDB All DBs Position 1524293..1524541 Genome browser AA seq 82 aa AA seqDB search MTKTEIFDQIKKMIVEQLDVDADKITMTTNFTEDLALDSLDVFEVIDKIEDEYDIEIETD DALATVGDLVDYVATHQETSED NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgactaaaactgaaatttttgaccaaattaaaaagatgatcgtggaacaattagacgtg gatgctgacaagattacgatgacaacgaactttaccgaagacttagcacttgatagtcta gacgtttttgaagtgatcgataagatcgaagacgaatatgatatcgaaatcgaaacggat gacgcgttagccacggttggtgatttagttgattatgtggcgactcatcaggaaactagc gaggactaa

DBGET integrated database retrieval system