Leclercia pneumoniae: KQ929_00775 Help Entry KQ929_00775       CDS       T08189                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lpnu  Leclercia pneumoniae Pathway lpnu01100   Metabolic pathways lpnu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpnu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KQ929_00775    00074 Mycolic acid biosynthesis     KQ929_00775   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KQ929_00775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QWW81646 LinkDB All DBs Position complement(167804..168061) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIISTLNLDELSADDIDTEAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESEEMRQHFFSVATLASFIHAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatcttgaaattaaaaatctaattatctccaccctgaacctggatgaa ctctccgccgacgatattgacaccgaggcggccctgttcggtgatggtctgggtctggat tccatcgacgcccttgagcttggcctggcggtcaaaaaccagtacggcgtggtgttatca gcggaaagcgaagagatgcgtcagcacttcttctccgttgccacgctggcatccttcatt catgctcaacgcgcctga

DBGET integrated database retrieval system