Leclercia pneumoniae: KQ929_12520 Help Entry KQ929_12520       CDS       T08189                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lpnu  Leclercia pneumoniae Pathway lpnu01100   Metabolic pathways lpnu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpnu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KQ929_12520 (acpP)    00074 Mycolic acid biosynthesis     KQ929_12520 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KQ929_12520 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  QWW78096 LinkDB All DBs Position complement(2524714..2524950) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system