Lonsdalea populi: I6N93_06665 Help Entry I6N93_06665       CDS       T06954                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lpop  Lonsdalea populi Pathway lpop00998   Biosynthesis of various antibiotics lpop01100   Metabolic pathways lpop01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpop00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I6N93_06665 (acpP)    00074 Mycolic acid biosynthesis     I6N93_06665 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I6N93_06665 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Motif Other DBs NCBI-ProteinID:  QPQ25442 LinkDB All DBs Position 1531096..1531332 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKPEEVVNNASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFIQANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacagcttggtgttaagccg gaagaagtcgtaaacaatgcttccttcgttgatgacctcggcgctgattctcttgacacc gttgagctggtaatggctttggaagaagagtttgataccgagattccagacgaagaagct gaaaaaatcactactgttcaggcagcgattgatttcattcaggcaaaccagcagtaa

DBGET integrated database retrieval system