Lonsdalea populi: I6N93_07445
Help
Entry
I6N93_07445 CDS
T06954
Symbol
dauA
Name
(GenBank) C4-dicarboxylic acid transporter DauA
KO
K03321
sulfate permease, SulP family
Organism
lpop
Lonsdalea populi
Brite
KEGG Orthology (KO) [BR:
lpop00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
lpop02000
]
I6N93_07445 (dauA)
Transporters [BR:
lpop02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
I6N93_07445 (dauA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sulfate_transp
STAS
Motif
Other DBs
NCBI-ProteinID:
QPQ25580
LinkDB
All DBs
Position
complement(1711001..1712716)
Genome browser
AA seq
571 aa
AA seq
DB search
MKSYLFNGIKPFSAFLDACWREKYTFNRFSQDFIAGITVGIIAIPLAMALAIASGVPPQF
GLYTAAVAGLITALCGGSRYSVSGPTAAFVVILYPVSQQFGLSGLLIATLLSGVFLLILG
LCRMGRLIEYIPVSVTLGFTSGIAITIATMQVKDFFGLTIPVMPEHYVGKVLALGSALPS
MHLGDTLIGIVTLAVLVTWPKLGIRLPGHLPALLAGTTVMGLLSLVDIHVATIGSRFSYL
LADGTSGHGIPPILPQFVLPWNMPGSDGSVVPLSWSTVSALLPAAFSMAILGAIESLLCA
VVLDGMTGRKHNSNTELIGQGIGNIVTPFFGGITATAAIARSAANVRAGATSPISAVVHA
LLVILALLVLAPWLSYLPLAAMASLLLLVAWNMSEAHKVIDLMRHAPKDDIIVMVLCLAL
TVLFDMVIAITVGIVLASILFMRRIAKMTRLSELPATVQGQRLVIRINGPLFFAAAERIF
GELLVSSNEYQTVVLQWDAVPVLDAGGLNALLRFIELLPPEKRLLITDIPFQPLKTLARA
NVVPIENRLAFYRTLEQALEAAPLTPLPLTA
NT seq
1716 nt
NT seq
+upstream
nt +downstream
nt
atgaaatcatacctatttaacggcattaaaccgttcagcgcgtttcttgacgcctgctgg
cgggaaaaatatacgttcaaccgtttttcccaagactttatcgccggtatcaccgtcggc
attattgctattcccctggcgatggcgctggcgatcgccagcggcgttcctcctcaattt
ggcctgtatacagccgcagtcgccggcctgatcaccgcgttatgcggcggctcacgttac
agcgtatccggccccacggcggcgttcgtcgtcattctctatccggtctcccagcagttc
ggtctttccggtctgttgatcgccacgctgctttccggggtgttcctgcttatcctcgga
ctctgtcgcatggggaggctgattgaatatattccggtgtcggtcactctgggcttcacc
tcgggtatcgcgatcactattgccacgatgcaggtcaaggatttcttcggtctgaccatt
ccggtgatgccggagcattacgtcggaaaagtgctggcgctgggcagcgcgctgccgtcc
atgcacttgggcgatacgctgatcggcatcgtcacgctggccgtgctggtgacttggccc
aagctcggcattcgcctgcccggtcatctgcctgcgctattagcggggacaacggtgatg
ggtctgctgtcgctggtggacattcacgtcgctactatcggttcacgtttcagctatctg
ctggctgacggcacgtcgggacacggtattccaccgatcctgcctcagttcgtcctgccg
tggaatatgccggggagtgacggcagcgtcgtgcccctgagctggagcaccgtttccgcc
ctgctgcccgccgccttctccatggcgatcctcggcgcgatcgagtccctgctctgtgcc
gtggtgcttgacggtatgaccggacgcaaacacaactccaataccgagctaatcggtcag
ggtatcggcaacattgtgacgccattctttgggggcatcaccgcgacggccgcaattgcc
cgttccgccgccaacgtgcgcgccggtgccacgtcgccgatttcggccgtggtgcatgcg
ctgctggtgatcctggcgctgctggtgctggcgccctggctgtcttatctgccgctggcg
gcgatggcctcgttgctgctgttggtcgcctggaacatgagcgaagcacacaaagttatc
gacctgatgcgtcatgcgccgaaagacgacattatcgtgatggtgctgtgcctggccctg
acggtgctgttcgatatggtgattgcaatcaccgtcggcatcgttctcgcctctatcctg
ttcatgcgtcggatagcgaaaatgacgcgccttagcgaactacccgccaccgtgcaaggg
cagcgtttggtgattcgtatcaacggcccgctgttctttgccgccgccgagcgtatcttc
ggcgaactattggtcagcagtaacgagtaccagaccgtcgtcctgcaatgggatgccgtg
ccggtactggatgcgggtggattgaacgcgctgttacgtttcatcgaactgctgccgccc
gaaaagcggctgctcattaccgacatcccattccagccgttgaagacgctggctcgcgcc
aacgtggtgccgatagaaaaccggctggcgttctatcggacgctggaacaggcgcttgaa
gcggcacccttgacgccgcttccgctgaccgcctga
DBGET
integrated database retrieval system