Lonsdalea populi: I6N93_16905 Help Entry I6N93_16905       CDS       T06954                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lpop  Lonsdalea populi Pathway lpop00998   Biosynthesis of various antibiotics lpop01100   Metabolic pathways lpop01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpop00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I6N93_16905    00074 Mycolic acid biosynthesis     I6N93_16905   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I6N93_16905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QPQ24202 LinkDB All DBs Position 3807803..3808087 Genome browser AA seq 94 aa AA seqDB search MDSLFIEIKQMMIDALNLEEVSVDEIETDAPLFGDGLGLDSIDALELGLAVKNRYGVVLS AESEAMRQHFFSVATLAAFITAQRSVNSDDKTMG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggatagtcttttcattgaaatcaaacaaatgatgattgatgcactgaacctcgaagag gtaagcgttgatgagattgagaccgatgcgccgttgtttggcgacgggctcggtttggat tctattgatgcacttgaactagggctggcggttaaaaatcgttatggcgtcgtgctctct gcagaaagtgaagcgatgcgtcagcatttcttctctgtcgccactctggctgcgttcatc accgcgcagcgttcagtgaattctgatgataaaacaatgggttaa

DBGET integrated database retrieval system