Lonsdalea populi: I6N93_16910 Help Entry I6N93_16910       CDS       T06954                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lpop  Lonsdalea populi Pathway lpop00998   Biosynthesis of various antibiotics lpop01100   Metabolic pathways lpop01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpop00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I6N93_16910    00074 Mycolic acid biosynthesis     I6N93_16910   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I6N93_16910 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding DUF3051 PP-binding_2 DIMCO_N Motif Other DBs NCBI-ProteinID:  QPQ24203 LinkDB All DBs Position 3808090..3808341 Genome browser AA seq 83 aa AA seqDB search MDKNDIYQEVTGLLVKLFELDADDITPESRLYEDLELDSIDAVDMVVHLQKRIGRKISPE TFKSVRTVQDVVTAVEHLLNEGQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggataagaacgatatttatcaggaagtcaccgggttgctggttaagcttttcgagctt gatgcggacgatatcactcctgagtcccgcttgtatgaggatctggaactcgacagcatc gatgctgtggatatggtggttcacctgcaaaaacgcatcggacggaaaatctctccggaa accttcaaatctgtacgcaccgtgcaggacgtcgttactgccgtcgaacatctgctcaat gaagggcaataa

DBGET integrated database retrieval system