Lactiplantibacillus plantarum subsp. plantarum P-8: LBP_cg2950
Help
Entry
LBP_cg2950 CDS
T02670
Name
(GenBank) Membrane protein oxaA 1
KO
K03217
YidC/Oxa1 family membrane protein insertase
Organism
lpr
Lactiplantibacillus plantarum subsp. plantarum P-8
Pathway
lpr02024
Quorum sensing
lpr03060
Protein export
lpr03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
lpr00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
LBP_cg2950
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
LBP_cg2950
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
LBP_cg2950
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
lpr03029
]
LBP_cg2950
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
lpr02044
]
LBP_cg2950
Mitochondrial biogenesis [BR:
lpr03029
]
Mitochondrial quality control factors
Mitochondrial respiratory chain complex assembly factors
Complex-IV assembly factors
LBP_cg2950
Secretion system [BR:
lpr02044
]
Sec (secretion) system
Prokaryotic Sec-SRP core components
LBP_cg2950
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
60KD_IMP
Ly49
Vpu
Motif
Other DBs
NCBI-ProteinID:
AJF17222
LinkDB
All DBs
Position
complement(3033776..3034486)
Genome browser
AA seq
236 aa
AA seq
DB search
MNFSRAIIWLSNLFGHSYGLGIIVFTLIIRIIILPLMIFQTRNMVAMQEVQPQMKALQKK
YSSRDMETQQKLQAEMKKLYAKHGVHPMASMLPLLVQLPILIALYQAIWRTQALKTGSFL
WLQLGSKDPYYVLPILAAIFTFASSWLAMKSQPEQNGMTTSMTYLMPVIILITAINVPSA
LSLYWVISNAFQVGQTLLLQNPFKINREREAKKQAERDRKRTLEKARKRAIRNHKR
NT seq
711 nt
NT seq
+upstream
nt +downstream
nt
ttgaacttctcacgggcgattatttggttatcaaacttgtttggtcatagttatggtctc
gggatcatcgtctttacgttgatcatccggatcattatcttgccattgatgatcttccaa
acccgcaacatggtagccatgcaagaagtccaaccgcagatgaaggctttgcaaaagaag
tattcgtcacgcgatatggaaactcagcaaaagctccaagcggaaatgaagaagttgtat
gccaagcatggtgtgcatccaatggccagcatgttgccattactagttcagttgcctatt
ttgattgcgttgtaccaagcaatctggcggacacaagccttgaagaccggttcgttctta
tggttgcaattaggtagcaaggatccgtactacgttttgccaattctagcggcgatcttt
acgtttgctagttcctggttagcgatgaagtcgcagccagaacaaaacgggatgacaacg
tcaatgacgtatttgatgcctgtgattattttgattacggccattaacgtgccatcagcg
ttgtccttgtactgggtgatttccaacgcgttccaagttggtcaaaccttgttattacaa
aacccattcaagattaatcgcgaacgggaagctaagaagcaagctgaacgtgatcgtaag
cgaacgcttgaaaaagctagaaagcgcgcgattcgtaatcataaacgttaa
DBGET
integrated database retrieval system