Luteibacter pinisoli: FIV34_13500 Help Entry FIV34_13500       CDS       T06035                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lpy  Luteibacter pinisoli Pathway lpy01100   Metabolic pathways lpy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FIV34_13500 (acpP)    00074 Mycolic acid biosynthesis     FIV34_13500 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FIV34_13500 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  QDE40160 UniProt:  A0A4Y5Z413 LinkDB All DBs Position complement(2992742..2992981) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEDEVTTNASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAVDYVKAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaagatcgtcgtcgaacagctgggcgtcaaggaa gatgaagtgaccacgaacgcctcgttcgtggacgatctgggcgctgattcgctggatacc gtcgaactcgtgatggctcttgaagaagagttcgagtgcgagatcccggacgaagaagcc gagaagatcacgacggttcagcaggctgtcgactacgtcaaggcccacgtcaaagcctga

DBGET integrated database retrieval system