Luteibacter pinisoli: FIV34_17415 Help Entry FIV34_17415       CDS       T06035                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism lpy  Luteibacter pinisoli Brite KEGG Orthology (KO) [BR:lpy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lpy03036]     FIV34_17415 (ftsL) Chromosome and associated proteins [BR:lpy03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     FIV34_17415 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  QDE40861 UniProt:  A0A4Y5Z6D6 LinkDB All DBs Position complement(3818516..3818788) Genome browser AA seq 90 aa AA seqDB search MKTFGAICLTLLLLAVIGSAIGVVWTRHESRVLFVELSRLQTQKDDIGVEYGRLELEQAT YAEPSRIDGDAREKLGMVPPKPQDIQLVRR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaagacctttggcgcgatctgcctcaccctgctcctgctggccgtcatcggcagcgcg atcggcgtggtgtggacgcgtcacgagagccgcgtgctcttcgtcgaactctcccgcctg cagacgcagaaggatgatatcggcgtggagtacggccgcctcgaactcgagcaggccact tacgccgagcccagccgcatcgatggcgatgcgcgcgagaagctcggcatggtgccgccg aagccgcaggacatccagctggtgcgtcgatga

DBGET integrated database retrieval system