Lactiplantibacillus plantarum 16: Lp16_1247 Help Entry Lp16_1247         CDS       T02698                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lpz  Lactiplantibacillus plantarum 16 Pathway lpz01100   Metabolic pathways lpz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lpz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Lp16_1247    00074 Mycolic acid biosynthesis     Lp16_1247   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Lp16_1247 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AGO07936 LinkDB All DBs Position 1355213..1355458 Genome browser AA seq 81 aa AA seqDB search MTKEEIFDKIADIIADRFEVDKATITNEMNLQTDLDADSIDFVEFVLELEDTFGSEISDE DAEKLSTVGEVVDYVAAHQAK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacgaaagaagaaattttcgataaaattgcggatatcattgctgatcggttcgaagtt gataaagcaacgattaccaacgaaatgaacttgcaaaccgatttggatgctgattccatc gattttgttgagtttgtactggaattagaagacacctttggtagcgaaatctcagacgaa gatgccgaaaaattgtcaacggtcggcgaagtcgtcgattacgtggcagcgcaccaagca aaataa

DBGET integrated database retrieval system