Lolium rigidum (rigid ryegrass): 124649883 Help Entry 124649883         CDS       T09103                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd04145   Phagosome lrd04148   Efferocytosis lrd04517   IgSF CAM signaling lrd04518   Integrin signaling lrd04620   Toll-like receptor signaling pathway lrd05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lrd00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     124649883    04518 Integrin signaling     124649883  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     124649883    04148 Efferocytosis     124649883  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124649883  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     124649883  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lrd04131]     124649883   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lrd04147]     124649883    04031 GTP-binding proteins [BR:lrd04031]     124649883 Membrane trafficking [BR:lrd04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     124649883  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     124649883   Macropinocytosis    Ras GTPases     124649883  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     124649883 Exosome [BR:lrd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124649883   Exosomal proteins of other body fluids (saliva and urine)    124649883   Exosomal proteins of colorectal cancer cells    124649883   Exosomal proteins of bladder cancer cells    124649883 GTP-binding proteins [BR:lrd04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     124649883 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Gtr1_RagA Motif Other DBs NCBI-GeneID:  124649883 NCBI-ProteinID:  XP_047045408 LinkDB All DBs Position 4:236121978..236127249 Genome browser AA seq 212 aa AA seqDB search MSVTKFIKCVTVGDGAVGKTCMLICYTSNRFPSDYIPTVFDNFSANVSVDGNIVNLGLWD TAGQEDYSRLRPLSYRGADIFVLAFSLISSASYENVLKKWMPELRRFAPNVPIVLVGTKL DLRDHRAYLADHPGASAITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQP PRRREVMAARKKTRRSSGCSIKHLMCGGTCVA NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgaccaagttcatcaagtgcgtcacggtgggcgacggcgccgtcggcaagaca tgcatgctcatctgctacaccagcaacaggttccccagtgactacatccccacagtgttc gacaacttcagcgccaatgtctccgtcgacggcaacatcgtcaatctcggcctatgggac accgccgggcaagaggactacagccggctgaggccgctgagctacagaggagccgacatc ttcgtgctggccttctccctcatcagcagcgccagctacgagaatgttctcaagaagtgg atgccggagctccgccggttcgcgcccaatgtccccatcgttcttgttggcaccaagcta gatctgcgtgaccacagagcctacctggctgaccatcctggcgcctcagcaatcacgact gcacagggcgaagaactcaggaagcagatcggcgccgctgcttacatcgaatgcagctcc aagacgcagcagaacgtcaaggctgtctttgacactgccatcaaggtggtccttcagccc ccaaggagaagggaggtgatggctgcccggaagaagactaggcgaagctctggatgctcc atcaagcacttgatgtgtggtggtacgtgcgttgcttag

DBGET integrated database retrieval system