Lolium rigidum (rigid ryegrass): 124649883 Help Entry 124649883         CDS       T09103                                  Name (RefSeq) rac-like GTP-binding protein 2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd04145   Phagosome lrd04148   Efferocytosis lrd04620   Toll-like receptor signaling pathway lrd05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lrd00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     124649883    04148 Efferocytosis     124649883  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124649883  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     124649883  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lrd04131]     124649883   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lrd04147]     124649883    04031 GTP-binding proteins [BR:lrd04031]     124649883 Membrane trafficking [BR:lrd04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     124649883  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     124649883   Macropinocytosis    Ras GTPases     124649883  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     124649883 Exosome [BR:lrd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124649883   Exosomal proteins of other body fluids (saliva and urine)    124649883   Exosomal proteins of colorectal cancer cells    124649883   Exosomal proteins of bladder cancer cells    124649883 GTP-binding proteins [BR:lrd04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     124649883 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Gtr1_RagA Motif Other DBs NCBI-GeneID:  124649883 NCBI-ProteinID:  XP_047045408 LinkDB All DBs Position 4:236121978..236127249 Genome browser AA seq 212 aa AA seqDB search MSVTKFIKCVTVGDGAVGKTCMLICYTSNRFPSDYIPTVFDNFSANVSVDGNIVNLGLWD TAGQEDYSRLRPLSYRGADIFVLAFSLISSASYENVLKKWMPELRRFAPNVPIVLVGTKL DLRDHRAYLADHPGASAITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQP PRRREVMAARKKTRRSSGCSIKHLMCGGTCVA NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgaccaagttcatcaagtgcgtcacggtgggcgacggcgccgtcggcaagaca tgcatgctcatctgctacaccagcaacaggttccccagtgactacatccccacagtgttc gacaacttcagcgccaatgtctccgtcgacggcaacatcgtcaatctcggcctatgggac accgccgggcaagaggactacagccggctgaggccgctgagctacagaggagccgacatc ttcgtgctggccttctccctcatcagcagcgccagctacgagaatgttctcaagaagtgg atgccggagctccgccggttcgcgcccaatgtccccatcgttcttgttggcaccaagcta gatctgcgtgaccacagagcctacctggctgaccatcctggcgcctcagcaatcacgact gcacagggcgaagaactcaggaagcagatcggcgccgctgcttacatcgaatgcagctcc aagacgcagcagaacgtcaaggctgtctttgacactgccatcaaggtggtccttcagccc ccaaggagaagggaggtgatggctgcccggaagaagactaggcgaagctctggatgctcc atcaagcacttgatgtgtggtggtacgtgcgttgcttag

DBGET integrated database retrieval system