Lolium rigidum (rigid ryegrass): 124655200 Help Entry 124655200         CDS       T09103                                  Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd03030   DNA replication lrd03410   Base excision repair lrd03420   Nucleotide excision repair lrd03430   Mismatch repair lrd03440   Homologous recombination Brite KEGG Orthology (KO) [BR:lrd00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     124655200    03410 Base excision repair     124655200    03420 Nucleotide excision repair     124655200    03430 Mismatch repair     124655200    03440 Homologous recombination     124655200  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lrd03032]     124655200    03400 DNA repair and recombination proteins [BR:lrd03400]     124655200 DNA replication proteins [BR:lrd03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     124655200 DNA repair and recombination proteins [BR:lrd03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       124655200    MMR (mismatch excision repair)     DNA polymerase delta complex      124655200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  124655200 NCBI-ProteinID:  XP_047050091 LinkDB All DBs Position 5:complement(241314857..241315657) Genome browser AA seq 126 aa AA seqDB search MASTGVKDFYRQKKKGGVAKTSSSSKKKTGASVGASNPAQMPALISHGSLDLKDDFSEQE EQLRQFDLDMKFGPCIGVNRLQRWERASAMGLQPPPHLRDLLSHASSVKNRNNGGPSPEC LWEGKI NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggcttctactggcgtgaaggatttctaccgtcagaagaagaaaggaggtgtcgccaaa acttcatcatcctctaagaagaaaacaggggcttctgttggggcatcaaatcctgctcag atgccagcactaatttctcacggatccttggatctcaaagatgacttcagtgagcaagag gagcagctgcggcagtttgacctggacatgaagtttggcccgtgcattggtgttaaccgg cttcagcgctgggagcgtgcttctgccatgggcctccagccaccgcctcatcttcgggat ctcttatctcacgcctcatctgttaagaatcgcaacaatggaggcccctcccccgagtgc ctctgggagggtaaaatctag

DBGET integrated database retrieval system