Lolium rigidum (rigid ryegrass): 124655455 Help Entry 124655455         CDS       T09103                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd03083   Polycomb repressive complex lrd04120   Ubiquitin mediated proteolysis lrd04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lrd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124655455    04120 Ubiquitin mediated proteolysis     124655455   09126 Chromosome    03083 Polycomb repressive complex     124655455  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lrd04131]     124655455    04121 Ubiquitin system [BR:lrd04121]     124655455    03036 Chromosome and associated proteins [BR:lrd03036]     124655455 Membrane trafficking [BR:lrd04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     124655455 Ubiquitin system [BR:lrd04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      124655455    Cul7 complex      124655455 Chromosome and associated proteins [BR:lrd03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      124655455   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      124655455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  124655455 NCBI-ProteinID:  XP_047050303 LinkDB All DBs Position 5:complement(161625535..161625990) Genome browser AA seq 149 aa AA seqDB search MITLISSDGEKFEIAQEAAAMSQTVNHMIEDNCVDDKGVKLPNVTSGILAKVIEYCNKHV AASGDSASEQDLKTFDVAFIKLDQATLYDIILAANFLEIKGLLDLSCQRVADMIKGKSPE EIRQTFNIKNDFTPEEEAEIRRENQWAFE NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgatcacgctgatcagctccgacggcgagaagttcgagatcgcgcaggaggcagcggcc atgtcccagaccgtcaaccacatgatcgaggacaactgcgtcgacgacaagggcgtcaag ctccccaacgtcacctccggcatactcgccaaggtcatcgagtactgtaacaagcacgtc gccgcctccggcgatagcgccagcgagcaggacctcaagacctttgacgtcgccttcatc aaattggatcaggccactctgtacgacatcatcctcgccgccaactttctggagatcaag ggcctcctcgacctcagctgccagagggtggctgacatgatcaagggcaagtcaccagag gaaatccgccagacgttcaacatcaagaatgacttcacgccggaggaggaggcagagatc cgcagggagaaccagtgggcatttgagtag

DBGET integrated database retrieval system