Lolium rigidum (rigid ryegrass): 124655523 Help Entry 124655523         CDS       T09103                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd03083   Polycomb repressive complex lrd04120   Ubiquitin mediated proteolysis lrd04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lrd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124655523    04120 Ubiquitin mediated proteolysis     124655523   09126 Chromosome    03083 Polycomb repressive complex     124655523  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lrd04131]     124655523    04121 Ubiquitin system [BR:lrd04121]     124655523    03036 Chromosome and associated proteins [BR:lrd03036]     124655523 Membrane trafficking [BR:lrd04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     124655523 Ubiquitin system [BR:lrd04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      124655523    Cul7 complex      124655523 Chromosome and associated proteins [BR:lrd03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      124655523   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      124655523 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  124655523 NCBI-ProteinID:  XP_047050356 LinkDB All DBs Position 5:161424485..161424943 Genome browser AA seq 150 aa AA seqDB search MITLISSDGEKFEIAQEAAAMSQTVNHMIEDNCVDDKGVKLPNVTSGILSKVIEYCNKHV AASGDIASEQDPKTFDVAFIIELDQATLYDIILAANFLEIKGLLDLSCQRVADMIKGKSP EEIRQTFNIKNDFTPEEEAEIRRENQWAFE NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgatcacgctgatcagctccgacggcgagaagttcgagatcgcgcaggaggcagcggcc atgtcccagaccgtcaaccacatgatcgaggacaactgcgtcgacgacaagggcgtcaag ctccccaacgtcacctccggcatactctccaaggtcatcgagtactgtaacaagcacgtc gccgcctccggcgatatcgccagcgagcaggaccccaagacctttgacgtcgccttcatc atcgaattggatcaggccactctgtacgacatcatcctcgccgccaactttctggagatc aagggcctcctcgacctcagctgccagagggtggctgacatgatcaagggcaagtcacca gaggaaatccgccagacgttcaacatcaagaatgacttcacgccggaggaggaggcagag atccgcagggagaaccagtgggcatttgagtag

DBGET integrated database retrieval system