Lolium rigidum (rigid ryegrass): 124657820 Help Entry 124657820         CDS       T09103                                  Name (RefSeq) SKP1-like protein 1 isoform X1   KO K03094   S-phase kinase-associated protein 1 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd03083   Polycomb repressive complex lrd04120   Ubiquitin mediated proteolysis lrd04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lrd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124657820    04120 Ubiquitin mediated proteolysis     124657820   09126 Chromosome    03083 Polycomb repressive complex     124657820  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lrd04131]     124657820    04121 Ubiquitin system [BR:lrd04121]     124657820    03036 Chromosome and associated proteins [BR:lrd03036]     124657820 Membrane trafficking [BR:lrd04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     124657820 Ubiquitin system [BR:lrd04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      124657820    Cul7 complex      124657820 Chromosome and associated proteins [BR:lrd03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      124657820   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      124657820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB DUF2960 Motif Other DBs NCBI-GeneID:  124657820 NCBI-ProteinID:  XP_047052272 LinkDB All DBs Position 5:complement(155700466..155701736) Genome browser AA seq 152 aa AA seqDB search MSSSSKMITLFSSDGERFEVTQEAAAMSQTIHHMMEDGCVDDEGVHLPNVGSEILAMVIE YCNRHVASPDEKEDIRSFDAGFVKVEHHTLFDIIRAANYLDVKELMDLCCQTVADSIKSK SVEEIRELFGIVNDFTPEEEAEIRKENQWAFE NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgtcgagcaagatgatcacgctgttcagctcggacggcgagcgcttcgaggtg acccaggaggcggcggccatgtcgcagaccatccaccacatgatggaggacggctgcgtg gacgacgagggcgtccatctccccaacgtgggatccgagatcctcgccatggtcatcgag tactgcaacaggcacgtggccagccccgacgagaaggaggacatcaggagcttcgacgcc ggcttcgtgaaggtggagcatcacacgctgttcgacatcatccgcgccgccaactacctg gacgtcaaggagctcatggacctttgctgccagacggtggccgactcgatcaagagcaag tcggtcgaggagattcgcgagctgttcggcatcgtgaacgacttcacgcccgaggaggag gcggagatccgcaaggagaaccagtgggcgttcgagtag

DBGET integrated database retrieval system