Lolium rigidum (rigid ryegrass): 124661553 Help Entry 124661553         CDS       T09103                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd04145   Phagosome lrd04148   Efferocytosis lrd04517   IgSF CAM signaling lrd04518   Integrin signaling lrd04620   Toll-like receptor signaling pathway lrd05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lrd00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     124661553    04518 Integrin signaling     124661553  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     124661553    04148 Efferocytosis     124661553  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124661553  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     124661553  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lrd04131]     124661553   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lrd04147]     124661553    04031 GTP-binding proteins [BR:lrd04031]     124661553 Membrane trafficking [BR:lrd04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     124661553  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     124661553   Macropinocytosis    Ras GTPases     124661553  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     124661553 Exosome [BR:lrd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124661553   Exosomal proteins of other body fluids (saliva and urine)    124661553   Exosomal proteins of colorectal cancer cells    124661553   Exosomal proteins of bladder cancer cells    124661553 GTP-binding proteins [BR:lrd04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     124661553 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  124661553 NCBI-ProteinID:  XP_047055372 LinkDB All DBs Position 6:complement(27775884..27779536) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLRDDEQFFVDHPGAVPISTTQGEELKKVIGATAYIECSSKTQQNIKAVFDAAIKVVLQP PKQRRRKRKARKGCAIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtctcggttcataaagtgcgtgacggtgggggacggcgccgtgggcaagacc tgtctcctcatctcctacacctccaacaccttccccacggattatgtcccgactgtcttt gacaacttcagcgcaaacgtcgtcgtcgatggaagcaccgtcaacctgggcttgtgggat acagcaggacaagaggactacaacaggctacgcccgctgagctaccgcggcgccgacgtc ttcctgctcgccttctccctcataagcaaagcaagctacgagaacgtctccaagaagtgg attcctgaattgaggcactatgctcctggtgtgcccatcattcttgttggcacaaagctt gatctgcgggatgacgaacagtttttcgtggaccaccccggtgcggttcctatctccacc actcagggtgaggagctgaaaaaggtaatcggcgcgacagcatacatcgagtgcagttcc aaaacgcagcagaatatcaaggctgtcttcgacgcggcgatcaaggtggttctccagccc ccgaagcagaggcggaggaagaggaaggcgcggaaagggtgtgccatcttatga

DBGET integrated database retrieval system