Lolium rigidum (rigid ryegrass): 124661553 Help Entry 124661553         CDS       T09103                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd04145   Phagosome lrd04148   Efferocytosis lrd04620   Toll-like receptor signaling pathway lrd05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lrd00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     124661553    04148 Efferocytosis     124661553  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124661553  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     124661553  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lrd04131]     124661553   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lrd04147]     124661553    04031 GTP-binding proteins [BR:lrd04031]     124661553 Membrane trafficking [BR:lrd04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     124661553  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     124661553   Macropinocytosis    Ras GTPases     124661553  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     124661553 Exosome [BR:lrd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124661553   Exosomal proteins of other body fluids (saliva and urine)    124661553   Exosomal proteins of colorectal cancer cells    124661553   Exosomal proteins of bladder cancer cells    124661553 GTP-binding proteins [BR:lrd04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     124661553 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  124661553 NCBI-ProteinID:  XP_047055372 LinkDB All DBs Position 6:complement(27775884..27779536) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLRDDEQFFVDHPGAVPISTTQGEELKKVIGATAYIECSSKTQQNIKAVFDAAIKVVLQP PKQRRRKRKARKGCAIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtctcggttcataaagtgcgtgacggtgggggacggcgccgtgggcaagacc tgtctcctcatctcctacacctccaacaccttccccacggattatgtcccgactgtcttt gacaacttcagcgcaaacgtcgtcgtcgatggaagcaccgtcaacctgggcttgtgggat acagcaggacaagaggactacaacaggctacgcccgctgagctaccgcggcgccgacgtc ttcctgctcgccttctccctcataagcaaagcaagctacgagaacgtctccaagaagtgg attcctgaattgaggcactatgctcctggtgtgcccatcattcttgttggcacaaagctt gatctgcgggatgacgaacagtttttcgtggaccaccccggtgcggttcctatctccacc actcagggtgaggagctgaaaaaggtaatcggcgcgacagcatacatcgagtgcagttcc aaaacgcagcagaatatcaaggctgtcttcgacgcggcgatcaaggtggttctccagccc ccgaagcagaggcggaggaagaggaaggcgcggaaagggtgtgccatcttatga

DBGET integrated database retrieval system