Lolium rigidum (rigid ryegrass): 124664932 Help Entry 124664932         CDS       T09103                                  Name (RefSeq) SKP1-like protein 4   KO K03094   S-phase kinase-associated protein 1 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd03083   Polycomb repressive complex lrd04120   Ubiquitin mediated proteolysis lrd04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lrd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124664932    04120 Ubiquitin mediated proteolysis     124664932   09126 Chromosome    03083 Polycomb repressive complex     124664932  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lrd04131]     124664932    04121 Ubiquitin system [BR:lrd04121]     124664932    03036 Chromosome and associated proteins [BR:lrd03036]     124664932 Membrane trafficking [BR:lrd04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     124664932 Ubiquitin system [BR:lrd04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      124664932    Cul7 complex      124664932 Chromosome and associated proteins [BR:lrd03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      124664932   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      124664932 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ AP3B1_C_2 Skp1 BTB Motif Other DBs NCBI-GeneID:  124664932 NCBI-ProteinID:  XP_047058300 LinkDB All DBs Position 6:complement(347819246..347819614) Genome browser AA seq 123 aa AA seqDB search MVTSSKTVMLRSSDGEELVVQAETMAAASMLIRDMLEDDGAGAGAGVIPLPKVTGRILAR VVDYCTCHYEAAHAVVNPDLERFDADFVGGMDHDTLMSLILAANYLDVQGLLGLACKTVA DRT NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggtgactagcagcaaaaccgtgatgctccgcagctcggacggcgaggagctcgtggtc caggcagagactatggcggcggcgtccatgctgatccgggacatgctggaggacgacggc gcgggcgccggcgccggcgtgatcccgctgcctaaggtgaccggccgcatcctcgctcgc gttgtcgactactgcacctgtcactatgaggccgcgcatgccgtcgtcaaccccgacctg gagcgcttcgacgccgacttcgtcggcggaatggaccatgacacgttgatgagcctcatc ctcgccgccaactacctcgacgtgcagggtctcttgggcctggcctgtaagacggtggcc gaccggacg

DBGET integrated database retrieval system