Lolium rigidum (rigid ryegrass): 124671622 Help Entry 124671622         CDS       T09103                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd04136   Autophagy - other Brite KEGG Orthology (KO) [BR:lrd00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     124671622  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lrd04131]     124671622    04121 Ubiquitin system [BR:lrd04121]     124671622    03029 Mitochondrial biogenesis [BR:lrd03029]     124671622 Membrane trafficking [BR:lrd04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     124671622 Ubiquitin system [BR:lrd04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    124671622 Mitochondrial biogenesis [BR:lrd03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     124671622 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  124671622 NCBI-ProteinID:  XP_047063933 LinkDB All DBs Position 1:complement(40688319..40692183) Genome browser AA seq 92 aa AA seqDB search MAADPNQKKVVVNFQSVANAPKLRQSKFKIGGNEKFAKVIEFLRRQIHQDTVFLYVNSAF SPNPDELIIDLYNNFGIDGQLVVNYASSLAWG NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggccgccgatcccaaccagaagaaagtcgtggtgaacttccagtcggtcgccaacgcg cccaagctgcggcagtccaagttcaagattggtgggaatgagaaatttgccaaggtgatt gaatttcttcgccgccaaattcaccaggacacagtgtttctctatgtgaacagtgcattt tcaccgaatccagatgagttgataattgatttatacaataactttggaattgatgggcag ctggtggtcaattatgcatcatcgttggcatggggttaa

DBGET integrated database retrieval system